PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 276aa    MW: 31746 Da    PI: 8.8231
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436844.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.85.2e-15421181298
                     HTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  12 ksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++   +p +f+ ++ +g+  ++++  +  + g++W vk+  ++++    l++GW++F+++++L+ gD++vF+++g++ f   v++f 
  XP_016436844.1  42 GTNTPKIPTSFL-KYlKGN--NHIEHAILRRAGKKWLVKV--KGRR----LEDGWEKFAEEHDLQYGDILVFRYEGDMAF--EVSIFH 118
                     5566789*****.554777..567899999**********..7777....**************************9999..888775 PP

2B354.42.3e-17174259594
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +++++ l++++l++pk+fa ++g+++++  +l+++de+ rsW++ l  r +s  +++++GW++  + + LkegD ++F+++ + e++++ 
  XP_016436844.1 174 TVRPYCLSKDILSIPKQFAWANGLINKK-CDLIIRDERQRSWNLIL--RSYSTNVYISGGWNKIRDTHCLKEGDRIMFEVVAN-EKKPTW 259
                     578999****************988654.59***************..*******************************9875.444554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010194.4E-1237120IPR003340B3 DNA binding domain
PfamPF023623.0E-1240118IPR003340B3 DNA binding domain
SuperFamilySSF1019361.61E-1644122IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-1744122IPR015300DNA-binding pseudobarrel domain
CDDcd100172.24E-1348117No hitNo description
PROSITE profilePS5086312.2148120IPR003340B3 DNA binding domain
SuperFamilySSF1019361.84E-18168263IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-16168256IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.589170267IPR003340B3 DNA binding domain
SMARTSM010191.3E-16171265IPR003340B3 DNA binding domain
PfamPF023622.2E-14173261IPR003340B3 DNA binding domain
CDDcd100176.59E-13178249No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAVLKQSHTC SNSYGYSERL QTFSETCVLQ SSSGSLFIGV FGTNTPKIPT SFLKYLKGNN  60
HIEHAILRRA GKKWLVKVKG RRLEDGWEKF AEEHDLQYGD ILVFRYEGDM AFEVSIFHSN  120
QCEDEQKAHN VEETSKKFEF KGKPNNSIKS SNKEFSHSEA AIHKPFGHSH FVCTVRPYCL  180
SKDILSIPKQ FAWANGLINK KCDLIIRDER QRSWNLILRS YSTNVYISGG WNKIRDTHCL  240
KEGDRIMFEV VANEKKPTWK FHAKSGEDAS IIQEVD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436844.10.0PREDICTED: B3 domain-containing protein REM17-like
TrEMBLK4CIB31e-79K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.14e-79(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-33B3 family protein